30electroluxhintsandtips

HintsovenForforparefandrt-economyicularlyheatedcookingshortesttipswhovenwhenlavepossible.placingusingthedortime,foodmainopentoa Arrgeonpsitionstheshlvesbeforswitchingthetherequiredoven frm.14Slfhebottompositionsupwardsarecounted.

1

thisclusteronWhenfreelydifferntfanwillforcokingbatchseveraloven,llowthetheshlvesbplaceestdishesmoreheatcookigdissratthanontoheciculatroneonethanrcentrallyesultsshlf,dish.in

thWhenargerod,osesamerecommendedof.gsiilar.timeVictoriaaking.sizewillsandwichonebetypecocas,okebakingfd

shouldItoadiniscokibeiquantitiesbengevenlytimecookedmaythespacedto.thatwhenshelfAbeslightnecessarypoitonsdirectincreaseuthe. Dopositionplceheovbas.buning;baseircirculatbkingtrayssuseitonntrferesandlowercanwithleadelfon

ovenHintsconventionalandtipswhencookingusingmain

ovlevbrownSingleThesults.of.levelcookingIfyoucookingrequireusethegivesmoremainbestthanfanone

raise,poitioheatmddledtheishouldstribution.gTobetweenimplyshelfincresealwaysposition.lowerallwsTtopcr.thforebrowningasethebaselfbest

etcYrkshireroombestfd2Thereentrally.5cmoking.,paceandfor(1”)okcakes,onrthepuddingsthetheinelementresultstinsyeapashelforetcthe.andy,beat.mixtures,baking.sconesThisgivestopWhallowseastoftraysthebread

StandromoEsureoallowthearounddishesforelfandatfoodmaximumthethereisisbakngtrayplacedcircsfficientucentrallylationordish.

degreehelpspillagebakingdtrayonontoucecleanitheonthebrowningovenfinishhelf.tablybasetopreventsizedandto

awaypolishedbrowningstickEnamlware,trayanThemateralutensilsandofdsteel.ibasegiveshesShianddak,ntrayscreaslessusedaluminiumbaseaffectavyflectbaseof.browningtheortheheatorthenonbaking-. theovenbaseDonotplacebkingdamgewilloccurtrysdirectlyon.

Page 30
Image 30
Electrolux EOU63102 user manual 30electroluxhintsandtips, OvenHintsconventionalandtipswhencookingusingmain

EOU63102 specifications

The Electrolux EOU63102 is a sleek and versatile built-in oven that embodies modern cooking technology while catering to the culinary needs of the contemporary home. Designed to deliver both style and functionality, this appliance integrates seamlessly into various kitchen designs, providing an elegant cooking solution.

One of the standout features of the EOU63102 is its multifunctional capabilities. This oven offers multiple cooking modes, including conventional baking, grilling, and fan-assisted cooking, which allows users to choose the ideal method for their culinary creations. The fan-assisted option ensures even heat distribution, enabling consistent cooking results.

The oven is equipped with a generous capacity, allowing for ample cooking space, ideal for handling large meals and family gatherings. The spacious interior is complemented by high-quality insulation, which enhances energy efficiency, making the EOU63102 not only a powerful kitchen ally but also an environmentally conscious choice.

Technology is at the heart of the Electrolux EOU63102. It features intuitive controls that simplify the cooking process, offering a clear and user-friendly display. Precise temperature control aids in achieving the best cooking results, while multiple levels of adjustable shelving allow for versatile meal preparations.

Another significant aspect of this oven is its self-cleaning function, designed to minimize the hassle of maintenance. The pyrolytic cleaning technology reduces food residue to ash, which can be effortlessly wiped away, ensuring a clean oven without the need for harsh chemicals. This makes it particularly appealing for busy households.

Safety is also a priority in the design of the EOU63102. The oven is equipped with a child lock feature, ensuring that little hands cannot interfere with cooking operations. Additionally, the oven's cool-touch door keeps the exterior safe to touch, reducing the risk of burns during cooking.

Lastly, the aesthetically pleasing design, characterized by clean lines and premium materials, makes the Electrolux EOU63102 a statement piece in any kitchen setting. With its blend of innovative technology, practical features, and elegant design, this oven is an excellent choice for those who love to cook and entertain. Whether baking, roasting, or grilling, the Electrolux EOU63102 stands out as a reliable and stylish addition to the modern kitchen.