Philips DTP4800 user manual WatchTV, Use on-screen guide, Use the program edit table

Page 10

Note

To enable the EasyLink feature, you must turn on the HDMI CEC operations on the TV and on other devices

FRQQHFWHGWR795HIHUWRWKH79VGHYLFHVPDQXDOIRU details.

2QHWRXFKSOD\

Press to turn on this product.

»7KH79LIVXSSRUWVRQHWRXFKSOD\ automatically turns on and switches to the correct video-in channel.

2QHWRXFKVWDQGE\

Press and hold on the remote control for more than 3 seconds.

»$OOWKHFRQQHFWHGGHYLFHVLIWKHGHYLFH VXSSRUWVRQHWRXFKVWDQGE\DXWRPDWLFDOO\ switch to standby.

Note

Philips does not guarantee 100% interoperability with all HDMI CEC devices.

5 WatchTV

Note

Before you start, ensure that you have connected properly the TV antenna to this product, and completed

WKHÀUVWWLPHLQVWDOODWLRQ

Press to turn on this product.

Turn on the TV, and select the video input channel on the TV.

3Press .

» The home menu is displayed.

4Select >/LYH79@, then press 2.. » TheTV mode is turned on.

5Press P + - or the Numeric buttons to select a channel.

Use on-screen guide

With this feature, you can view the program schedule and program details.

In the TV mode, press *8,'(. » The program list is displayed.

To view the details of a program, select the program and press .

Use the program edit table

With the program edit table, you can set favorite channels, or adjust channel sequence or delete channels.

In the TV mode, press .

» The home menu is displayed.

Select >6\VWHP6HWWLQJ@ > >795DGLR6HWWLQJ@ >

>&KDQQHO@ > >79&KDQQHO@, then press 2.. » The program table is displayed.

6HWIDYRULWHFKDQQHOV

Create a shortlist of favorite programs to access quickly.

In the TV mode, press )$9.

» A program table is displayed.

In the >)$9@ column select a channel, then press 2..

»A heart-shaped symbol is displayed in the >)$9@ column to indicate the channel is marked as a favorite.

10(1

Image 10

Contents Register your product and get support at DTP4800 HEUXLNVDDQZLMLQJ$7,21 Ć6.$538%/,.$$65 $87,21 INSIDE, Near the Deck Mechanism WdoldContents Batteries 6DIHW\DQGLPSRUWDQWQRWLFH$ERXW3URJUHVVLYH6FDQ Copyright notice3URGXFWRYHUYLHZ Remote controlPlayable media Region codes‡ $FFHVVWKHPHQXRIFUHDWLQJ03ÀOHV ConnectConnectTV antenna ‡ 6NLSSOD\WRDVSHFLÀFSRLQW79 YLGHRMDFNVProduct ‡ the antenna input on the TV 2SWLRQ&RQQHFWWRWKH+0,MDFNGet started Connect powerPrepare the remote control RQQHFW86%ÁDVKGULYH6HOHFWPHQXGLVSOD\ODQJXDJH LUVWWLPHVHWXS8VHWKH+RPHPHQX 7XUQRQSURJUHVVLYHVFDQUse on-screen guide WatchTVUse the program edit table Delete a channel 9LHZIDYRULWHFKDQQHOV$GMXVWFKDQQHOVHTXHQFH » DY2Q@IDYRULWHRQLVGLVSOD\HG3OD\IURP86%GHYLFH PlayPlay a disc 3OD\YLGHRPlay music Play photoUHDWH03ÀOHV General settings2WKHUIHDWXUHV 9LHZÀOHVE\W\SH+0,6HWXS@ 9LGHR6HWXS@$XGLR6HWXS@ PrFRQQHFWLRQ3UHIHUHQFH6HWXS@ 86%VHWWLQJVXVWRP6HWXS@ KDQQHO6HDUFK@ TV/Radio settingsKDQQHO@ QRWLÀFDWLRQ8SGDWHVRIWZDUH CareMain unit Picture1RDXGLRRXWSXWIURPWKH79 6RXQGPlay 1RVRXQGGXULQJLYYLGHRSOD\EDFNDXWKRULWDWLYHGHÀQLWLRQRIWKHREOLJDWLRQV ECosGNU General Public License 138Questions and answers GNU General Public License 139UHÁHFWRQWKHRULJLQDODXWKRUV·UHSXWDWLRQV 18*15$/38%/,&/,&16 Version 2, JunePreamble 18*15$/38%/,&/,&16PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJHRU DQQRXQFHPHQWLQWHUFKDQJHRU 141142 235,*+7+2/525$127+53$57+20$02,$1255,675,%87 No WarrantyHow to Apply These Terms to Your New Programs 143GNU Library General Public License OLEJFFSignature of Ty Coon, 1 April Ty Coon, President of Vice 144UHÁHFWRQWKHRULJLQDODXWKRUV·UHSXWDWLRQV PXVWVWLOOFRPSXWHVTXDUHURRWV 7KHPRGLÀHGZRUNPXVWLWVHOIEHDVRIWZDUHOLEUDU\146 UHYHUVHHQJLQHHULQJIRUGHEXJJLQJVXFKPRGLÀFDWLRQV UHFRPSLOHWKHDSSOLFDWLRQWRXVHWKHPRGLÀHGGHÀQLWLRQV 148Party has Been Advised of the Possibility of Such Damages 235,*+7+2/525$127+53$57+20$02,$1255,675,%877+149 Appendix How to Apply These Terms to Your New Libraries RS\ULJKW&\HDU!QDPHRIDXWKRU